CAN_340

origin: Crystal Structures of the Human Doublecortin C- and N-terminal Domains in Complex with Specific Antibodies.
author: Burger, D., Stihle, M., Sharma, A., Di Lello, P., Benz, J., D'Arcy, B., Debulpaep, M., Fry, D., Hube
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: IIGGNHWA(predict)
CDR1_length: 8
CDR2_seq: SLSRYNAN(predict)
CDR2_length: 8
CDR3_seq: ENYY(predict)
CDR3_lentgh: 4
protein_seq: QVQLQESGGGLVQAGGSLRLSCTASVNIIGGNHWAWYRQAPGQQRDLVASLSRYNANYADSVKGRFTISRDNAKNAAYLQMNSLKPEDTAIYFCALENYYWGQGTQVTVSSHHHHHHEPEA
DNA_seq: not known
PubMed_ID: 27226599
PDB_ID: 5IP4
PDB_deposition_date: 2016-03-09
PDB_released_date: 2016-05-18
resolution: 1.81Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: Neuronal migration protein doublecortin
antigen_chain: not known
antigen_source: Homo sapiens (human)
antigen_seq: ARENKDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVF IACGPEKFRYA
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: obtain structures of two doublecortin domains
validationORprediction: Experiment Validation
bacteria_family: Escherichia coli
publication: J Biol Chem. 2016 Jul 29;291(31):16292-306. doi: 10.1074/jbc.M116.726547. Epub 2016 May 10.