CAN_341

origin: Crystal structure of the proteasomal deubiquitylation module Rpn8-Rpn11
author: Pathare, G.R., Nagy, I., Sledz, P., Anderson, D.J., Zhou, H.J., Pardon, E., Steyaert, J., Forster, F
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TFSSTVMA(predict)
CDR1_length: 8
CDR2_seq: TIRWSGGNTY(predict)
CDR2_length: 10
CDR3_seq: GTYYGTLSYKYDF(predict)
CDR3_lentgh: 13
protein_seq: MQVQLQESGGGLVPAGGSLRLSCVDSGRTFSSTVMAWFRQAPGKEREFVATIRWSGGNTYYADSVKGRFTISRDNARNTVYLQMNSLKPEDTAVYYCAGGTYYGTLSYKYDFWGRGTQVTVSSHHHHHHEPEA
DNA_seq: not known
PubMed_ID: 24516147
PDB_ID: 4OCL
PDB_deposition_date: 2014-01-09
PDB_released_date: 2014-01-29
resolution: 2.4Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: the proteasomal deubiquitylation module Rpn8-Rpn11
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: crystallization aid
validationORprediction: Experimentally Validated
bacteria_family: Escherichia coli
publication: Proc Natl Acad Sci U S A. 2014 Feb 25;111(8):2984-9. doi: 10.1073/pnas.1400546111. Epub 2014 Feb 10.