CAN_342

origin: Probing the N-Terminal beta-Sheet Conversion in the Crystal Structure of the Human Prion Protein Bound to a Nanobody
author: Abskharon, R.N., Giachin, G., Wohlkonig, A., Soror, S.H., Pardon, E., Legname, G., Steyaert, J.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TFSSYNMG(predict)
CDR1_length: 8
CDR2_seq: SITSSGDKSD(predict)
CDR2_length: 10
CDR3_seq: GLGIYIIRARGGYDH(predict)
CDR3_lentgh: 15
protein_seq: AAQLQESGGGLVQPGGSLRLSCAASGRTFSSYNMGWFRQAPGKGREFVASITSSGDKSDYTDSVKGRFTISRDNAKNTMYLQMNNLKPEDTATYYCARGLGIYIIRARGGYDHWGQGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID: 24400836
PDB_ID: 4N9O
PDB_deposition_date: 2013-10-21
PDB_released_date: 2014-01-22
resolution: 1.5Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: human prion protein
antigen_chain: not known
antigen_source: Human Prion
antigen_seq: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVT
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: inhibits prion propagation
validationORprediction: Experimentally Validated
bacteria_family: Escherichia coli
publication: J Am Chem Soc. 2014 Jan 22;136(3):937-44. doi: 10.1021/ja407527p. Epub 2014 Jan 8.