CAN_345

origin: Structure of Cyclin G-Associated Kinase (Gak) Trapped in Different Conformations Using Nanobodies
author: Chaikuad, A., Keates, T., Vincke, C., Kaufholz, M., Zenn, M., Zimmermann, B., Gutierrez, C., Zhang,
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TSRMG(predict)
CDR1_length: 5
CDR2_seq: CIHRQSNLSY(predict)
CDR2_length: 10
CDR3_seq: TTDCAAFVERAT(predict)
CDR3_lentgh: 12
protein_seq: QVQLQESGGGSVQAGGSLRLSCGASEYTSRMGWFRQAPGAEREGVACIHRQSNLSYYSDSVRGRFTISQDNAKTTAFLLMSSLKPEDTAIYYCATTTDCAAFVERATAITAGQGTQVTVSSAAAYPYDVPDYGSHHHHHH
DNA_seq: not known
PubMed_ID: 24438162
PDB_ID: 4C59
PDB_deposition_date: 2013-09-10
PDB_released_date: 2013-10-09
resolution: 2.8Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: cyclin G-associated kinase
antigen_chain: catalytic domain
antigen_source: Homo sapiens (human)
antigen_seq: SMPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKK LSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIH RDLKVENLLLSNQGTIKLCDFGSATTISHYPDYSWSAQ
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: gain insight into conformational changes of dynamic molecules
validationORprediction: Experimentally Validated
bacteria_family: Escherichia coli
publication: Biochem J. 2014 Apr 1;459(1):59-69. doi: 10.1042/BJ20131399.