CAN_346

origin: Structural Evaluation of EGFR Inhibition Mechanisms for Nanobodies/VHH Domains
author: Schmitz, K.R., Bagchi, A., Roovers, R.C., van Bergen En Henegouwen, P.M.P., Ferguson, K.M.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TSRSYGMG(predict)
CDR1_length: 8
CDR2_seq: GISWRGDSTG(predict)
CDR2_length: 10
CDR3_seq: AAGSAWYGTLYEYDY(predict)
CDR3_lentgh: 15
protein_seq: QVKLEESGGGSVQTGGSLRLTCAASGRTSRSYGMGWFRQAPGKEREFVSGISWRGDSTGYADSVKGRFTISRDNAKNTVDLQMNSLKPEDTAIYYCAAAAGSAWYGTLYEYDYWGQGTQVTVSSALEHHHHHH
DNA_seq: not known
PubMed_ID: 23791944
PDB_ID: 4KRL
PDB_deposition_date: 2013-05-16
PDB_released_date: 2013-08-28
resolution: 2.85Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: EGFR(The epidermal growth factor receptor)
antigen_chain: domain III of the extracellular region
antigen_source: Homo sapiens (human)
antigen_seq: LEEKKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAW PENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKI ISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRN
epitope: LAVVSLNITSLGLRSLKE/KLFGTSGQK
IEDB_ID: 543590/480686
epitope_reference: not known
function: tumor imaging and/or cancer therapy
validationORprediction: Experimentally Validated
bacteria_family: Escherichia coli, Spodoptera frugiperda
publication: Structure. 2013 Jul 2;21(7):1214-24. doi: 10.1016/j.str.2013.05.008. Epub 2013 Jun 20.