CAN_350

origin: The structure of the D3 domain of Plasmodium falciparum myosin tail interacting protein MTIP in complex with a nanobody
author: Khamrui, S., Turley, S., Pardon, E., Steyaert, J., Fan, E., Verlinde, C.L., Bergman, L.W., Hol, W.G.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: RAFSNYAMG(predict)
CDR1_length: 9
CDR2_seq: GITGSGRSQY(predict)
CDR2_length: 10
CDR3_seq: RVVPVFSDSTKGYVY(predict)
CDR3_lentgh: 15
protein_seq: EVQLQESGGGTVQPGGSLKLSCSAAPERAFSNYAMGWFRQAPGQEREFVAGITGSGRSQYYADSVKGRFTISRDNAMNAVYLQMNSVKAEDTAVYYCAARVVPVFSDSTKGYVYWGQGTQVTVSSHHHHHHEPEA
DNA_seq: not known
PubMed_ID: 23831371
PDB_ID: 4GFT
PDB_deposition_date: 2012-08-03
PDB_released_date: 2013-07-03
resolution: 1.6Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: Malaria invasion machinery protein
antigen_chain: not known
antigen_source: Homo sapiens (human)
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: crystallization aid
validationORprediction: Experimentally Validated
bacteria_family: Escherichia coli
publication: Mol Biochem Parasitol. 2013 Aug;190(2):87-91. doi: 10.1016/j.molbiopara.2013.06.003. Epub 2013 Jul 4.