CAN_351

origin: Mapping the Conformational Space Accessible to Bace2 Using Surface Mutants and Co-Crystals with Fab-Fragments, Fynomers, and Xaperones
author: Banner, D.W., Gsell, B., Benz, J., Bertschinger, J., Burger, D., Brack, S., Cuppuleri, S., Debulpaep
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TFSSAIMT(predict)
CDR1_length: 8
CDR2_seq: TIGSDGSITT(predict)
CDR2_length: 10
CDR3_seq: AGRRGPGTQVTV(predict)
CDR3_lentgh: 12
protein_seq: QVQLQESGGGLVQPGGSLRLSCAASGFTFSSAIMTWVRQAPGKGREWVSTIGSDGSITTYADSVKGRFTISRDNARNTLYLQMNSLKPEDTAVYYCTSAGRRGPGTQVTVSSHHHHHHEPEA
DNA_seq: not known
PubMed_ID: 23695257
PDB_ID: 3ZKQ
PDB_deposition_date: 2013-01-24
PDB_released_date: 2013-05-29
resolution: 1.51Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: The aspartic protease BACE2
antigen_chain: not known
antigen_source: Homo sapiens (human)
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: crystallization aid
validationORprediction: Experimentally Validated
bacteria_family: Escherichia coli
publication: Acta Crystallogr D Biol Crystallogr. 2013 Jun;69(Pt 6):1124-37. doi: 10.1107/S0907444913006574. Epub 2013 May 15.