CAN_353

origin: A Llama-Derived Gelsolin Single-Domain Antibody Blocks Gelsolin-G-Actin Interaction
author: Van Den Abbeele, A., De Clercq, S., De Ganck, A., De Corte, V., Van Loo, B., Soror, S.H., Srinivasan
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: NLRMYRMG(predict)
CDR1_length: 8
CDR2_seq: TMVWSSDTIY(predict)
CDR2_length: 10
CDR3_seq: GAGWAGTMTDYNY(predict)
CDR3_lentgh: 13
protein_seq: QVQLQESGGGLVQAGGSLRLSCAAAGRNLRMYRMGWFRQAPGKEREFVGTMVWSSDTIYYADSVKGRFIISRDNAKNTVYLQMNSLKPEDTAVYYCAAGAGWAGTMTDYNYWGQGTQVTVSS
DNA_seq: not known
PubMed_ID: 20140750
PDB_ID: 2X1O
PDB_deposition_date: 2010-01-03
PDB_released_date: 2011-01-12
resolution: 1.34Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: gelsolin
antigen_chain: not known
antigen_source: Homo sapiens (human)
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: blocking structural proteins
validationORprediction: Experimentally Validated
bacteria_family: Escherichia coli
publication: Cell Mol Life Sci. 2010 May;67(9):1519-35. doi: 10.1007/s00018-010-0266-1. Epub 2010 Feb 7.