CAN_356

origin: Nanobody binding to a conserved epitope promotes norovirus particle disassembly
author: Koromyslova, A.D., Hansman, G.S.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: IFSIYAMG(predict)
CDR1_length: 8
CDR2_seq: SISSGGGTN(predict)
CDR2_length: 9
CDR3_seq: EDYSAYAPPSGS(predict)
CDR3_lentgh: 12
protein_seq: DVQLVESGGGLVQPGGSLRLSCAASGSIFSIYAMGWYRQAPGKQRELVASISSGGGTNYADSVKGRFTISGDNAKNTVYLQMNSLKPEDTAVYYCKREDYSAYAPPSGSRGRGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID: 27409812
PDB_ID: 4X7D
PDB_deposition_date: 2014-12-09
PDB_released_date: 2014-12-31
resolution: 2.15Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: Human noroviruses capsid protein
antigen_chain: 2012 NSW GII.4 P domain
antigen_source: Human noroviruses
antigen_seq: SKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTTQLSPVNICTFRGDVTHITGSRNYTMNL ASQNWNDYDPTEEIPAPLGTPDFVGKIQGVLTQTTRTDGSTRGHKATVYTGSADFAPKLGRVQFETDTDRDFEANQNTKF TPVGVIQDGGTTHRNEPQQWVLPSYSGRNTHNVHLAPA
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: work as a diagnostic reagent in norovirus detection systems but also could function as a broadly reactive GII norovirus antiviral
validationORprediction: Experimentally Validated
bacteria_family: Escherichia coli
publication: J Virol. 2015 Mar;89(5):2718-30. doi: 10.1128/JVI.03176-14. Epub 2014 Dec 17.