CAN_357

origin: Adrenaline-activated structure of beta 2-adrenoceptor stabilized by an engineered nanobody
author: Ring, A.M., Manglik, A., Kruse, A.C., Enos, M.D., Weis, W.I., Garcia, K.C., Kobilka, B.K.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: IFALNIMG(predict)
CDR1_length: 8
CDR2_seq: AIHSGGTTN(predict)
CDR2_length: 9
CDR3_seq: KDFGAIIYDYDY(predict)
CDR3_lentgh: 12
protein_seq: QVQLQESGGGLVQAGGSLRLSCAASGSIFALNIMGWYRQAPGKQRELVAAIHSGGTTNYANSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDFGAIIYDYDYWGQGTQVTVSS
DNA_seq: not known
PubMed_ID: 25520510
PDB_ID: 4LDE
PDB_deposition_date: 2013-06-24
PDB_released_date: 2013-09-25
resolution: 2.79Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: Beta-2 adrenergic receptor
antigen_chain: not known
antigen_source: Homo sapiens (human)
antigen_seq: DYKDDDDAENLYFQGNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKL FNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRA KRVITTFRTGTWDAYAADEVWVVGMGIVMSLIVLAIVF
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: obtain the first active-state structure of the beta2AR
validationORprediction: Experimentally Validated
bacteria_family: cloned into the periplasmic expression vector pET26b, transformed into BL21(DE3) Rosetta2 E. coli (N
publication: Nature. 2013 Oct 24;502(7472):575-9. doi: 10.1038/nature12572. Epub 2013 Sep 22.