CAN_358

origin: Viral infection modulation and neutralization by camelid nanobodies
author: Desmyter, A., Farenc, C., Mahony, J., Spinelli, S., Bebeacua, C., Blangy, S., Veesler, D., van Sinde
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: SFDDYAIG(predict)
CDR1_length: 8
CDR2_seq: YISMSDGRTY(predict)
CDR2_length: 10
CDR3_seq: GRFVTFGSAWSFVGGGPYGIDY(predict)
CDR3_lentgh: 22
protein_seq: DVQLVESGGGLVQPGGSLRLSCEASGFSFDDYAIGWFRQAPGKEREGVSYISMSDGRTYVADSVTGRFTISSDNAKNTVYLQMNSLKLEDTAVYYCAAGRFVTFGSAWSFVGGGPYGIDYWGKGTLVTVSS
DNA_seq: not known
PubMed_ID: 24056936
PDB_ID: 4HEP
PDB_deposition_date: 2012-10-04
PDB_released_date: 2013-03-20
resolution: 1.75Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,pan,express
antigen: lactococcal phage TP901-1
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: circumventing lactococcal phages viral infection on dairy fermentation
validationORprediction: Experimentally Validated
bacteria_family: subcloned into the pHEN6 expression vector (28),transform to Escherichia coli,
publication: Proc Natl Acad Sci U S A. 2013 Apr 9;110(15):E1371-9. doi: 10.1073/pnas.1301336110. Epub 2013 Mar 25.