CAN_360

origin: Crystal structure of the beta2 adrenergic receptor-Gs protein complex
author: Rasmussen, S.G., DeVree, B.T., Zou, Y., Kruse, A.C., Chung, K.Y., Kobilka, T.S., Thian, F.S., Chae,
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TFSNYKMN(predict)
CDR1_length: 8
CDR2_seq: DISQSGASIS(predict)
CDR2_length: 10
CDR3_seq: CPAPFTRDCFDVTSTTYAY(predict)
CDR3_lentgh: 19
protein_seq: QVQLQESGGGLVQPGGSLRLSCAASGFTFSNYKMNWVRQAPGKGLEWVSDISQSGASISYTGSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCARCPAPFTRDCFDVTSTTYAYRGQGTQVTVSSHHHHHHEPEA
DNA_seq: not known
PubMed_ID: 23530214
PDB_ID: 3SN6
PDB_deposition_date: 2011-06-28
PDB_released_date: 2011-07-20
resolution: 3.2Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,pan,express
antigen: Beta-2 adrenergic receptor
antigen_chain: not known
antigen_source: Homo sapiens (human)
antigen_seq: DYKDDDDAENLYFQGNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKL FNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRA KRVITTFRTGTWDAYAADEVWVVGMGIVMSLIVLAIVF
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: crystallization aid
validationORprediction: Experimentally Validated
bacteria_family: Escherichia coli
publication: Nature. 2011 Jul 19;477(7366):549-55. doi: 10.1038/nature10361.