CAN_361

origin: Structure of a nanobody-stabilized active state of the β2 adrenoceptor
author: Rasmussen, S.G., Choi, H.J., Fung, J.J., Pardon, E., Casarosa, P., Chae, P.S., DeVree, B.T., Rosenba
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: IFSINTMG(predict)
CDR1_length: 8
CDR2_seq: AIHSGGSTN(predict)
CDR2_length: 9
CDR3_seq: KDYGAVLYEYDY(predict)
CDR3_lentgh: 12
protein_seq: QVQLQESGGGLVQAGGSLRLSCAASGSIFSINTMGWYRQAPGKQRELVAAIHSGGSTNYANSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDYGAVLYEYDYWGQGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID: 21772288
PDB_ID: 3P0G
PDB_deposition_date: 2010-09-28
PDB_released_date: 2011-01-19
resolution: 3.5Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,pan,express
antigen: Beta-2 adrenergic receptor
antigen_chain: not known
antigen_source: Homo sapiens (human)
antigen_seq: DYKDDDDAENLYFQGNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKL FNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRA KRVITTFRTGTWDAYAADEVWVVGMGIVMSLIVLAIVF
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: crystallization aid
validationORprediction: Experimentally Validated
bacteria_family: expressed in the periplasm of E. coli strain WK6
publication: Nature. 2011 Jan 13;469(7329):175-80. doi: 10.1038/nature09648.