CAN_362

origin: The unexpected structure of the designed protein Octarellin V.1 forms a challenge for protein structure prediction tools
author: Figueroa, M., Sleutel, M., Vandevenne, M., Parvizi, G., Attout, S., Jacquin, O., Vandenameele, J., F
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TFSTYGMG(predict)
CDR1_length: 8
CDR2_seq: ASSWTGANTY(predict)
CDR2_length: 10
CDR3_seq: RRWLGGSYFDPGNYDF(predict)
CDR3_lentgh: 16
protein_seq: QVQLQESGGGLVQAGGSLRLSCAASGGTFSTYGMGWFRQAPGKEREFVAASSWTGANTYYADSVRGRFTISRDNAKNTVYLEMNSLKPEDTAVYYCAARRWLGGSYFDPGNYDFWGQGTQVTVSSHHHHHHEPEA
DNA_seq: not known
PubMed_ID: 21228869
PDB_ID: 5BOP
PDB_deposition_date: 2015-05-27
PDB_released_date: 2016-05-25
resolution: 1.95Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,pan,express
antigen: the artificial protein Octarellin V
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: protein design
validationORprediction: Experimentally Validated
bacteria_family: Escherichia coli
publication: J Struct Biol. 2016 Jul;195(1):19-30. doi: 10.1016/j.jsb.2016.05.004. Epub 2016 May 12.