CAN_363

origin: A nanobody binding to non-amyloidogenic regions of the protein human lysozyme enhances partial unfolding but inhibits amyloid fibril formation.
author: De Genst, E., Chan, P.H., Pardon, E., Hsu, S.T., Kumita, J.R., Christodoulou, J., Menzer, L., Chirga
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: STTVMA(predict)
CDR1_length: 6
CDR2_seq: AIYTGDGFPY(predict)
CDR2_length: 10
CDR3_seq: KTGAFSYGSLWWMSRAYNH(predict)
CDR3_lentgh: 19
protein_seq: QVQLQESGGGSVQAGGSLRLSCEASGLSTTVMAWFRQAPGKEREGVAAIYTGDGFPYYADSVKGRFTISQDNAKNRMYLQMNSLEPEDTAMYYCAAKTGAFSYGSLWWMSRAYNHWGQGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID: 23791944
PDB_ID: 4I0C
PDB_deposition_date: 2012-11-16
PDB_released_date: 2013-10-09
resolution: 1.95Å
source_organism: Camelus dromedarius
experiment_method: dromedary immunization,library construction,pan,express
antigen: WT-HuL(wild-type human lysozyme)
antigen_chain: not known
antigen_source: Homo sapiens (human)
antigen_seq: KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLS CSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: therapeutics to combat protein misfolding diseases
validationORprediction: Experimentally Validated
bacteria_family: Escherichia coli
publication: J Phys Chem B. 2013 Oct 24;117(42):13245-58. doi: 10.1021/jp403425z. Epub 2013 Sep 24.