CAN_364

origin: Atomic Structure of a Nanobody-Trapped Domain-Swapped Dimer of an Amyloidogenic {Beta}2-Microglobulin Variant.
author: Domanska, K., Vanderhaegen, S., Srinivasan, V., Pardon, E., Dupeux, F., Marquez, J.A., Giorgetti, S.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TDSRYCMA(predict)
CDR1_length: 8
CDR2_seq: RINSGRDITY(predict)
CDR2_length: 10
CDR3_seq: DIPLRCRDIVAKGGDGFRY(predict)
CDR3_lentgh: 19
protein_seq: QVQLQESGGGSVQAGGSLRLSCAASGYTDSRYCMAWFRQAPGKEREWVARINSGRDITYYADSVKGRFTFSQDNAKNTVYLQMDSLEPEDTATYYCATDIPLRCRDIVAKGGDGFRYWGQGTQVTVSS
DNA_seq: not known
PubMed_ID: 21220305
PDB_ID: 2X89
PDB_deposition_date: 2010-03-07
PDB_released_date: 2011-01-19
resolution: 2.16Å
source_organism: Camelus dromedarius
experiment_method: One camel (Camelus dromedarius) and one llama (Llama glama) immunization,library construction,pan,express
antigen: Beta2_microglobulin
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: Structure biology
validationORprediction: Experimentally Validated
bacteria_family: Escherichia coli
publication: Proc Natl Acad Sci U S A. 2011 Jan 25;108(4):1314-9. doi: 10.1073/pnas.1008560108. Epub 2011 Jan 10.