CAN_365

origin: General Strategy to Humanize a Camelid Single-domain Antibody and Identification of a Universal Humanized Nanobody Scaffold
author: Vincke, C., Loris, R., Saerens, D., Martinez-Rodriguez, S., Muyldermans, S., Conrath, K.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TYISG(predict)
CDR1_length: 5
CDR2_seq: AIRSSDGTTY(predict)
CDR2_length: 10
CDR3_seq: TEVAGWPLDIGIYDY(predict)
CDR3_lentgh: 15
protein_seq: QVQLVESGGGSVQAGGSLRLSCSASGYTYISGWFRQAPGKGLEWVAAIRSSDGTTYYADSVKGRFTISQDNAKNTVYLQMNSLKPEDTAMYYCAATEVAGWPLDIGIYDYWGQGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID:  19010777
PDB_ID: 3EBA
PDB_deposition_date: 2008-08-27
PDB_released_date: 2008-12-02
resolution: 1.85Å
source_organism: Camelus dromedarius
experiment_method: not known
antigen: human lysozyme(HuL)
antigen_chain: not known
antigen_source: Homo sapiens (human)
antigen_seq: KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLS CSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: General Strategy to Humanize a Camelid Single-domain Antibody
validationORprediction: Experimentally Validated
bacteria_family: Escherichia coli
publication: J Biol Chem. 2009 Jan 30;284(5):3273-84. doi: 10.1074/jbc.M806889200. Epub 2008 Nov 14.