CAN_367

origin: Five of Five VHHs Neutralizing Poliovirus Bind the Receptor-Binding Site
author: Strauss, M., Schotte, L., Thys, B., Filman, D.J., Hogle, J.M.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TFSHGYMA(predict)
CDR1_length: 8
CDR2_seq: CVRTSGVSAY(predict)
CDR2_length: 10
CDR3_seq: TSISCSSGYMF(predict)
CDR3_lentgh: 11
protein_seq: QVQLQESGGGSAQTGGSLRLSCAASGFTFSHGYMAWFRQAPEKEREWVACVRTSGVSAYYADSVLGRFTISQDNAKSTLYLQMNNLKPEDTAMYYCAATSISCSSGYMFWGQGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID: 26764003
PDB_ID: 3JBD
PDB_deposition_date: 2015-08-26
PDB_released_date: 2016-01-27
resolution: 4.8Å
source_organism: Camelus dromedarius
experiment_method: not known
antigen: poliovirus type 1
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: antiviral agents or reagents for standardization of vaccine quality control
validationORprediction: Experiment Validation
bacteria_family: not known
publication: J Virol. 2016 Jan 13;90(7):3496-505. doi: 10.1128/JVI.03017-15.