CAN_371

origin: Structural Basis of Nanobody-Mediated Plant Virus Resistance and Vector Transmission Revealed by Cryo-Em.
author: Hemmer, C., Orlov, I., Ackerer, L., Marmonier, A., Hleibieh, K., Schmitt-Keichinger, C., Vigne, E., 
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TFSGYLAA(predict)
CDR1_length: 8
CDR2_seq: AINSKRHTTS(predict)
CDR2_length: 10
CDR3_seq: ADAIGLAEYWSTPTLSAARYKY(predict)
CDR3_lentgh: 22
protein_seq: QVQLQESGGGSVQVGGSLRVACAASGDTFSGYLAAWFRQAPGKGREGVAAINSKRHTTSYADSVKGRFTISKDNADNIMYLEMNSLKPEDTAIYYCAAADAIGLAEYWSTPTLSAARYKYWGQGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID: not known
PDB_ID: 5FOJ
PDB_deposition_date: 2015-11-22
PDB_released_date: 2016-01-20
resolution: 2.8Å
source_organism: Camelus dromedarius
experiment_method: not known
antigen: Grapevine Fanleaf Virus
antigen_chain: not known
antigen_source: GLAGRGVIYIPKDCQANRYLGTLNIRDMISDFKGVQYEKWITAGLVMPTFKIVIRLPANAFTGLTWVMSFDAYNRITSRI TASADPVYTLSVPHWLIHH
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: Structure biology
validationORprediction: Experiment Validation
bacteria_family: not known
publication: not known