CAN_372

origin: The Atomic Structure of the Phage Tuc2009 Baseplate Tripod Suggests that Host Recognition Involves Two Different Carbohydrate Binding Modules.
author: Legrand, P., Collins, B., Blangy, S., Murphy, J., Spinelli, S., Gutierrez, C., Richet, N., Kellenber
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TFDDSDMG(predict)
CDR1_length: 8
CDR2_seq: AIFSDGSTY(predict)
CDR2_length: 9
CDR3_seq: ATTTVASPPVRHVCNGY(predict)
CDR3_lentgh: 17
protein_seq: QVQLVESGGGSVQAGGSLRLSCTASGFTFDDSDMGWYHQAPGNECELVSAIFSDGSTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAMYYCAAATTTVASPPVRHVCNGYWGQGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID: 26814179
PDB_ID: 5E7B
PDB_deposition_date: 2015-10-12
PDB_released_date: 2015-12-30
resolution: 1.1Å
source_organism: Camelus dromedarius
experiment_method: not known
antigen: phage Tuc2009 RBP (BppL ORF53)
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: crystallization aid
validationORprediction: Experiment Validation
bacteria_family: not known
publication: MBio. 2016 Jan 26;7(1):e01781-15. doi: 10.1128/mBio.01781-15.