CAN_374

origin: Crystal structure of the metazoan Nup62Nup58Nup54 nucleoporin complex.
author: Chug, H., Trakhanov, S., Hulsmann, B.B., Pleiner, T., Gorlich, D.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TFSNYAMS(predict)
CDR1_length: 8
CDR2_seq: DIGSGGDRIT(predict)
CDR2_length: 10
CDR3_seq: QYGRGPGTQVTV(predict)
CDR3_lentgh: 12
protein_seq: AGTASQVQLQESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEVVSDIGSGGDRITYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCANQYGRGPGTQVTVSSGS
DNA_seq: not known
PubMed_ID: 26292704
PDB_ID: 5C3L
PDB_deposition_date: 2015-06-17
PDB_released_date: 2015-08-26
resolution: 2.9Å
source_organism: Camelus dromedarius
experiment_method: not known
antigen: the metazoan Nup62.Nup58.Nup54 nucleoporin complex
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: crystallization aid
validationORprediction: Experiment Validation
bacteria_family: not known
publication: Science. 2015 Oct 2;350(6256):106-10. doi: 10.1126/science.aac7420. Epub 2015 Aug 20.