CAN_375

origin: Structural and thermodynamic analysis of the GFP:GFP-nanobody complex.
author: Kubala, M.H., Kovtun, O., Alexandrov, K., Collins, B.M.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: PVNRYSMR(predict)
CDR1_length: 8
CDR2_seq: GMSSAGDRSS(predict)
CDR2_length: 10
CDR3_seq: NVGFEY(predict)
CDR3_lentgh: 6
protein_seq: MQVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGKEREWVAGMSSAGDRSSYEDSVKGRFTISRDDARNTVYLQMNSLKPEDTAVYYCNVNVGFEYWGQGTQVTVSSKHHHHHH
DNA_seq: not known
PubMed_ID: 20945358
PDB_ID: 3OGO
PDB_deposition_date: 2010-08-17
PDB_released_date: 2010-08-25
resolution:  2.8Å
source_organism: Camelus dromedarius
experiment_method: not known
antigen: GFP
antigen_chain: not known
antigen_source: Aequorea victoria
antigen_seq: MAHHHHHHSSGVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLGYGVQ CFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN VYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTP
epitope: HYLSTQSAL/DFFKSAMPEGYVQER/LFTGVVPILV/HDFFKSAMPEGYVQE
IEDB_ID: 225956/227085/227335/242574
epitope_reference: Rad23 as a reciprocal agent for stimulating or repressing immune responses./Removing T-cell epitopes with computational protein design./Removing T-cell epitopes with computational protein design./T cell receptor cross-reactivity between similar foreign and self peptides influences naive cell population size and autoimmunity.
function: fluorescent probes 
validationORprediction: Experiment Validation
bacteria_family: not known
publication: Protein Sci. 2010 Dec;19(12):2389-401. doi: 10.1002/pro.519.