CAN_377

origin: Modulation of protein properties in living cells using nanobodies
author: Kirchhofer, A., Helma, J., Schmidthals, K., Frauer, C., Cui, S., Karcher, A., Pellis, M., Muylderman
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TFSSYSMA(predict)
CDR1_length: 8
CDR2_seq: NILRDGTTT(predict)
CDR2_length: 9
CDR3_seq: DSGTQLGYVGAVGLSCLDYVMDY(predict)
CDR3_lentgh: 23
protein_seq: MADVQLQESGGGSVQAGGSLRLSCAASGDTFSSYSMAWFRQAPGKECELVSNILRDGTTTYAGSVKGRFTISRDDAKNTVYLQMVNLKSEDTARYYCAADSGTQLGYVGAVGLSCLDYVMDYWGKGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID: 20010839
PDB_ID: 3G9A
PDB_deposition_date: 2009-02-13
PDB_released_date: 2009-12-08
resolution: 1.61Å
source_organism: Camelus dromedarius
experiment_method: not known
antigen: GFP
antigen_chain: not known
antigen_source: Aequorea victoria
antigen_seq: MGKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKR HDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNG IKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDN
epitope: HYLSTQSAL/DFFKSAMPEGYVQER/LFTGVVPILV/HDFFKSAMPEGYVQE
IEDB_ID: 225956/227085/227335/242574
epitope_reference: Rad23 as a reciprocal agent for stimulating or repressing immune responses./Removing T-cell epitopes with computational protein design./Removing T-cell epitopes with computational protein design./T cell receptor cross-reactivity between similar foreign and self peptides influences naive cell population size and autoimmunity.
function: manipulated and studied protein conformations
validationORprediction: Experiment Validation
bacteria_family: not known
publication: Nat Struct Mol Biol. 2010 Jan;17(1):133-8. doi: 10.1038/nsmb.1727. Epub 2009 Dec 13.