CAN_380

origin: General strategy to humanize a camelid single-domain antibody and identification of a universal humanized nanobody scaffold.
author: Vincke, C., Loris, R., Saerens, D., Martinez-Rodriguez, S., Muyldermans, S., Conrath, K.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: SEYSYSTFSLG(predict)
CDR1_length: 11
CDR2_seq: AIASMGGLTY(predict)
CDR2_length: 10
CDR3_seq: VRGYFMRLPSSHNFRY(predict)
CDR3_lentgh: 16
protein_seq: QVQLVESGGGLVQPGGSLRLSCAASGGSEYSYSTFSLGWFRQAPGQGLEAVAAIASMGGLTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAVRGYFMRLPSSHNFRYWGQGTLVTVSSRGRHHHHHH
DNA_seq: not known
PubMed_ID: 19010777
PDB_ID: 3EAK
PDB_deposition_date: 2008-08-26
PDB_released_date: 2008-12-02
resolution: 1.95Å
source_organism: Camelus dromedarius
experiment_method: not known
antigen: not known
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: structure biology
validationORprediction: Experiment Validation
bacteria_family: not known
publication: J Biol Chem. 2009 Jan 30;284(5):3273-84. doi: 10.1074/jbc.M806889200. Epub 2008 Nov 14.