CAN_383

origin: A Camelid-derived Antibody Fragment Targeting the Active Site of a Serine Protease Balances between Inhibitor and Substrate Behavior
author: Kromann-Hansen, T., Oldenburg, E., Yung, K.W., Ghassabeh, G.H., Muyldermans, S.,Declerck, P.J., Huan
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TLDSYAIG(predict)
CDR1_length: 8
CDR2_seq: CISASGGSTN(predict)
CDR2_length: 10
CDR3_seq: DHPGLCTSESGRRRYLEV(predict)
CDR3_lentgh: 18
protein_seq: QVQLQESGGGLVQAGGSLRLSCAASGFTLDSYAIGWFRQAPGKEREGVSCISASGGSTNYADSVKGRFTISRDNAKNTVYLQMNSLKSEDTAVYYCAADHPGLCTSESGRRRYLEVWGQGTQVTVSSA
DNA_seq: not known
PubMed_ID: 27226628
PDB_ID: 5HGG
PDB_deposition_date: 2015-08-26
PDB_released_date: 2016-01-27
resolution: 1.97Å
source_organism: Vicugna pacos
experiment_method: not known
antigen: uPA(Urokinase-type plasminogen activator)
antigen_chain: not known
antigen_source: Homo sapiens
antigen_seq: IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVEN LILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVK LISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDS
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: a strong inhibitor as well as a poor substrate
validationORprediction: Experimentally Validated
bacteria_family: not known
publication: J Biol Chem. 2016 Jul 15;291(29):15156-68. doi: 10.1074/jbc.M116.732503. Epub 2016 May 23.