CAN_384

origin: Peptides in headlock-a novel high-affinity and versatile peptide-binding nanobody for proteomics and microscopy.
author: Braun, M.B., Traenkle, B., Koch, P.A., Emele, F., Weiss, F., Poetz, O., Stehle, T., Rothbauer, U.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TLDHYDIG(predict)
CDR1_length: 8
CDR2_seq: CINNSDDDTY(predict)
CDR2_length: 10
CDR3_seq: ARGCKRGRYEYDF(predict)
CDR3_lentgh: 13
protein_seq: QVQLVESGGGLVQPGGSLTLSCTASGFTLDHYDIGWFRQAPGKEREGVSCINNSDDDTYYADSVKGRFTIFMNNAKDTVYLQMNSLKPEDTAIYYCAEARGCKRGRYEYDFWGQGTQVTVSSKKKHHHHHH
DNA_seq: not known
PubMed_ID: 26791954
PDB_ID: 5IVO
PDB_deposition_date: 2015-08-26
PDB_released_date: 2016-01-27
resolution: 1.8Å
source_organism: Vicugna pacos
experiment_method: not known
antigen: not known
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: proteomics and microscopy
validationORprediction: Experimentally Validated
bacteria_family: not known
publication: Sci Rep. 2016 Jan 21;6:19211. doi: 10.1038/srep19211.