CAN_386

origin: Five of Five VHHs Neutralizing Poliovirus Bind the Receptor-Binding Site.
author: Tarr, A.W., Lafaye, P., Meredith, L., Damier-Piolle, L., Urbanowicz, R.A.,Meola, A., Jestin, J.L., B
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TDDYYAIG(predict)
CDR1_length: 8
CDR2_seq: CITNFDGGTY(predict)
CDR2_length: 10
CDR3_seq: DKGLCSWLRAGGKVTFGS(predict)
CDR3_lentgh: 18
protein_seq: MAEVQLQASGGGLVQPGGSLRLSCTASGFTDDYYAIGWFRQAPGKEREGVSCITNFDGGTYYADSVKSRFTMSRDNAKNTVYLQMNSLKPEDTAVYYCAADKGLCSWLRAGGKVTFGSWGQGTQVTVSSAAALEHHHHHHHHH
DNA_seq: not known
PubMed_ID: 23553604
PDB_ID: 4JVP
PDB_deposition_date: 2015-11-22
PDB_released_date: 2016-01-20
resolution: 1.76Å
source_organism: Vicugna pacos
experiment_method: immunize the alpaca,construct the phage-display library,
antigen: Hepatitis C virus (HCV) glycoprotein E2
antigen_chain: not known
antigen_source: Hepatitis C virus (HCV)
antigen_seq: HVLRLPQTLFDIIAGAHWGILAGLAYYSMQGNWAKVAIIVVMFSGVDAETHVTGGSAGRTAFSMVGLFTP GARQNLQLINTNGSW
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: antiviral therapy
validationORprediction: Experimentally Validated
bacteria_family: not known
publication: Hepatology. 2013 Sep;58(3):932-9. doi: 10.1002/hep.26430. Epub 2013 Jul 30.