CAN_388

origin: Nanobody binding to a conserved epitope promotes norovirus particle disassembly.
author: Koromyslova, A.D., Hansman, G.S.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: IFSIYAMG(predict)
CDR1_length: 8
CDR2_seq: SISSGGGTN(predict)
CDR2_length: 9
CDR3_seq: EDYSAYAPPSGS(predict)
CDR3_lentgh: 12
protein_seq: DVQLVESGGGLVQPGGSLRLSCAASGSIFSIYAMGWYRQAPGKQRELVASISSGGGTNYADSVKGRFTISGDNAKNTVYLQMNSLKPEDTAVYYCKREDYSAYAPPSGSRGRGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID: 25520510
PDB_ID: 4X7C
PDB_deposition_date: 2015-06-16
PDB_released_date: 2015-08-26
resolution:
source_organism: Vicugna pacos
experiment_method: not known
antigen: The capsid protein Saga-2006 GII.4
antigen_chain: P domain
antigen_source: Norwalk virus
antigen_seq: SKPFTVPILTVEEMTNSRFPIPLEKLFTGPSGAFVVQPQNGRCTTDGVLLGTTQLSPVNICTFRGDVTHIAGSRNYTMNL ASLNWNNYDPTEEIPAPLGTPDFVGKIQGLLTQTTKGDGSTRGHKATVYTGSAPFTPKLGSVQFSTDTENDFETHQNTKF TPVGVIQDGSTTHRNEPQQWVLPSYSGRNVHNVHLAPA
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: promotes norovirus particle disassembly
validationORprediction: Experimentally Validated
bacteria_family: not known
publication: J Virol. 2015 Mar;89(5):2718-30. doi: 10.1128/JVI.03176-14. Epub 2014 Dec 17.