CAN_390

origin: Structural Insights into Polymorphic ABO Glycan Binding by Helicobacter pylori.
author: Moonens, K., Gideonsson, P., Subedi, S., Bugaytsova, J., Romao, E.,Mendez, M., Norden, J., Fallah, M
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: IFSGNVMG(predict)
CDR1_length: 8
CDR2_seq: AITPQGVPN(predict)
CDR2_length: 9
CDR3_seq: LPNYRS(predict)
CDR3_lentgh: 6
protein_seq: QVQLQESGGGLVQPGGSLRLSCAASGSIFSGNVMGWYRQAPGKLREWVAAITPQGVPNYADSVKGRFTISRDNAKNMLYLQMSSLKPEDTALYYCNRLPNYRSWGQGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID: 26764597
PDB_ID: 5F7N
PDB_deposition_date: 2012-11-16
PDB_released_date: 2013-10-09
resolution: 2.28Å
source_organism: Vicugna pacos
experiment_method: not known
antigen: The Helicobacter pylori adhesin BabA binds mucosal ABO/Le(b) blood group (bg) carbohydrates
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: Structure biology
validationORprediction: Experimentally Validated
bacteria_family: not known
publication: Cell Host Microbe. 2016 Jan 13;19(1):55-66. doi: 10.1016/j.chom.2015.12.004.