CAN_391

origin: Crystal structure of the N-terminal domain of the secretin GspDPm ETEC determined with the assistance of a nanobody.
author: Korotkov, K.V., Pardon, E., Steyaert, J., Hol, W.G.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: IFSINSMD(predict)
CDR1_length: 8
CDR2_seq: TITSGGSTN(predict)
CDR2_length: 9
CDR3_seq: NVKTWAGMTRDY(predict)
CDR3_lentgh: 12
protein_seq: QVQLQESGGGLVQAGGSLRLSCAASGSIFSINSMDWDRQAPGKQRELVATITSGGSTNYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNANVKTWAGMTRDYWGQGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID: 19217396
PDB_ID: 3EZJ
PDB_deposition_date: 2008-10-22
PDB_released_date: 2009-02-17
resolution: 2.8Å
source_organism: Lama glama
experiment_method: immunize a llama,construct a library,ligated into a pHEN4 phagemid vector ,transformed in E. coli TG1 cells
antigen: GspD (peri-GspD) from the type 2 secretion system (T2SS) secretin
antigen_chain: the periplasmic N-terminal domain
antigen_source: Escherichia coli
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: crystallization aid
validationORprediction: Experimentally Validated
bacteria_family: not known
publication: Structure. 2009 Feb 13;17(2):255-65. doi: 10.1016/j.str.2008.11.011.