CAN_318

origin: Structural Insights into Polymorphic ABO Glycan Binding by Helicobacter pylori.
author: Moonens, K., Gideonsson, P., Subedi, S., Bugaytsova, J., Romao, E., Mendez, M., Norden, J., Fallah,
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: IYSLIAMG(predict)
CDR1_length: 8
CDR2_seq: TISSGSTTY(predict)
CDR2_length: 9
CDR3_seq: YSDRLTDCSNCEADY(predict)
CDR3_lentgh: 15
protein_seq: QVQLQESGGGLVQPGGSLRLSCAASGSIYSLIAMGWYRQAPGKEHELVATISSGSTTYYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAMYYCAAYSDRLTDCSNCEADYWGQGTQVTVSHHHHHHH
DNA_seq: not known
PubMed_ID: 26764597
PDB_ID: 5F7L
PDB_deposition_date: 2015-12-08
PDB_released_date: 2016-01-20
resolution: 2.74Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: adhesin BabA of Helicobacter pylori strain 17876
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: crystallization aid
validationORprediction: Experiment Validation
bacteria_family: Escherichia coli
publication: Cell Host Microbe. 2016 Jan 13;19(1):55-66. doi: 10.1016/j.chom.2015.12.004.