CAN_319

origin: Structure of a prokaryotic fumarate transporter reveals the architecture of the SLC26 family.
author: Geertsma, E.R., Chang, Y.N., Shaik, F.R., Neldner, Y., Pardon, E., Steyaert, J., Dutzler, R.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TFSSDVMG(predict)
CDR1_length: 8
CDR2_seq: AVTRSGGKSY(predict)
CDR2_length: 10
CDR3_seq: GDTAITSWYGYDY(predict)
CDR3_lentgh: 13
protein_seq: GPSQVQLQESGGGLVQAGGSLRLSCAASGRTFSSDVMGWFRQAPGKEREFVAAVTRSGGKSYNADSVKGRFTISRDNAKNTVSLQMNSLKPEDTAVYYCAAGDTAITSWYGYDYWGQGTQVTVS
DNA_seq: not known
PubMed_ID: 26367249
PDB_ID: 5DA0
PDB_deposition_date: 2015-08-19
PDB_released_date: 2015-09-09
resolution: 3.2Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: the SLC26 transporter SLC26Dg
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: crystallization aid
validationORprediction: Experiment Validation
bacteria_family: Escherichia coli
publication: Nat Struct Mol Biol. 2015 Oct;22(10):803-8. doi: 10.1038/nsmb.3091. Epub 2015 Sep 14.