CAN_322

origin: Nanobody Mediated Inhibition of Attachment of F18 Fimbriae Expressing Escherichia coli.
author: Moonens, K., De Kerpel, M., Coddens, A., Cox, E., Pardon, E., Remaut, H., De Greve, H.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TYSSNCMA(predict)
CDR1_length: 8
CDR2_seq: SINTRGGITY(predict)
CDR2_length: 10
CDR3_seq: VREATYSDNRCSVRSYTYDY(predict)
CDR3_lentgh: 20
protein_seq: QVQLQESGGGSVQAGGSLRLSCAASGYTYSSNCMAWFRQVPGKEREGVASINTRGGITYYADSVKGRFTISRDNAKNTVSLQMNSLKPEDTATYYCAAVREATYSDNRCSVRSYTYDYWGQGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID: 25502211
PDB_ID: 4W6Y
PDB_deposition_date: 2014-08-21
PDB_released_date: 2014-12-17
resolution: 1.57Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: the lectin domain of F18 fimbrial adhesin FedF
antigen_chain: the lectin domain 
antigen_source: Escherichia coli
antigen_seq: NSSASSAQVTGTLLGTGKTNTTQMPALYTWQHQIYNVNFIPSSSGTLTCQAGTILVWKNGRETQYALECRVSIHHSSGSI NESQWGQQSQVGFGTACGNKKCRFTGFEISLRIPPNAQTYPLSSGDLKGSFSLTNKEVNWSASIYVPAIAK
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: Post-weaning diarrhea and edema disease of piglets
validationORprediction: Experiment Validation
bacteria_family: Escherichia coli
publication: PLoS One. 2014 Dec 11;9(12):e114691. doi: 10.1371/journal.pone.0114691. eCollection 2014.