CAN_323

origin: Crystal structure of a SLC11 (NRAMP) transporter reveals the basis for transition-metal ion transport.
author: Ehrnstorfer, I.A., Geertsma, E.R., Pardon, E., Steyaert, J., Dutzler, R.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: IFSIDTAN(predict)
CDR1_length: 8
CDR2_seq: TITRDGNAN(predict)
CDR2_length: 9
CDR3_seq: AIRTTVRTSAQEY(predict)
CDR3_lentgh: 13
protein_seq: GPSQVQLQESGGGLVQAGGSLRLSCAASRSIFSIDTANWYRQPPGMQRELVATITRDGNANYADSVKGRFTISRDRARNTVYLQMNSLKPEDTGVYYCNAAIRTTVRTSAQEYWGQGTQVTVSS
DNA_seq: not known
PubMed_ID: 25326704
PDB_ID: 4WGV
PDB_deposition_date: 2014-09-19
PDB_released_date: 2014-10-22
resolution: 3.1Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: DMT(Staphylococcus capitis divalent metal ion transporter)
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: Structure biology
validationORprediction: Experiment Validation
bacteria_family: Escherichia coli
publication: Nat Struct Mol Biol. 2014 Nov;21(11):990-6. doi: 10.1038/nsmb.2904. Epub 2014 Oct 19.