CAN_325

origin: The Molecular Mechanism of Shiga Toxin Stx2e Neutralization by a Single-domain Antibody Targeting the Cell Receptor-binding Domain.
author: Lo, A.W., Moonens, K., De Kerpel, M., Brys, L., Pardon, E., Remaut, H., De Greve, H.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: IFRLSTMG(predict)
CDR1_length: 8
CDR2_seq: SITSYGDTN(predict)
CDR2_length: 9
CDR3_seq: NIEAGTYYGPGRDY(predict)
CDR3_lentgh: 14
protein_seq: QVQLQESGGGLVQAGGSLRLSCAVSGSIFRLSTMGWYRQAPGKQREFVASITSYGDTNYRDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNANIEAGTYYGPGRDYWGQGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID: 25053417
PDB_ID: 4P2C
PDB_deposition_date: 2014-02-18
PDB_released_date: 2014-07-30
resolution: 2.82Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: Shiga Toxin Stx2e
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: prevent or treat edema disease
validationORprediction: Experiment Validation
bacteria_family: E.coli WK6
publication: J Biol Chem. 2014 Sep 5;289(36):25374-81. doi: 10.1074/jbc.M114.566257. Epub 2014 Jul 22.