CAN_327

origin: Exploring an alternative antibody interaction mechanism
author: Oyen, D., Steyaert, J., Barlow, J.N.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: LTVDYAIG(predict)
CDR1_length: 8
CDR2_seq: AISWGGGLTV(predict)
CDR2_length: 10
CDR3_seq: SRISYAVWNTIPYNKLTL(predict)
CDR3_lentgh: 18
protein_seq: QVQLQESGGGLVQAGASLRLSCAASERLTVDYAIGWFRQAPGKEREFVAAISWGGGLTVYGESVEGRFTISRDIAKNTMNLQMNVLRPEDTANYYCAASRISYAVWNTIPYNKLTLWGRGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID: not known
PDB_ID: 4I1N
PDB_deposition_date: 2012-11-21
PDB_released_date: 2013-11-27
resolution: 1.89Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: the DHFR.folate binary complex
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: Exploring an alternative antibody interaction mechanism
validationORprediction: Experiment Validation
bacteria_family: Escherichia coli
publication: not known