CAN_331

origin: Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
author: Baranova, E.,Pnzes, R., Garcia-Pino, A., Van Gerven, N., Papapostolou, D., Pehau-Arnaudet, G., Pardo
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TSSAYAMG(predict)
CDR1_length: 8
CDR2_seq: GISSKGGSTY(predict)
CDR2_length: 10
CDR3_seq: SDKYNFDTSHAGYGY(predict)
CDR3_lentgh: 15
protein_seq: QVQLQESGGGLVQAGGSLRLSCAASGRTSSAYAMGWFRQAPGKEREFVAGISSKGGSTYYGASMKGRFTISRDNAKNTVYLQMNGLAPEDTAVYYCAASDKYNFDTSHAGYGYWGQGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID: 22722836
PDB_ID: 4AQ1
PDB_deposition_date: 2012-04-12
PDB_released_date: 2012-06-13
resolution: 2.42Å
source_organism: Lama glama
experiment_method: not known
antigen: the SbsB S-layer protein of Geobacillus stearothermophilus PV72p2
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: crystallization aid
validationORprediction: Experiment Validation
bacteria_family: Escherichia coli
publication: Nature. 2012 Jul 5;487(7405):119-22. doi: 10.1038/nature11155.