CAN_333

origin: Crystal structure of the N-terminal domain of the secretin GspDPm ETEC determined with the assistance of a nanobody.
author: Korotkov, K.V., Pardon, E., Steyaert, J., Hol, W.G.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: IFSINSMD(predict)
CDR1_length: 8
CDR2_seq: TITSGGSTN(predict)
CDR2_length: 9
CDR3_seq: NVKTWAGMTRDY(predict)
CDR3_lentgh: 12
protein_seq: QVQLQESGGGLVQAGGSLRLSCAASGSIFSINSMDWDRQAPGKQRELVATITSGGSTNYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNANVKTWAGMTRDYWGQGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID: 19217396
PDB_ID: 3EZJ
PDB_deposition_date: 2008-10-22
PDB_released_date: 2009-02-17
resolution: 2.8Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: the secretin GspDPm ETEC
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: crystallization aid
validationORprediction: Experiment Validation
bacteria_family: Escherichia coli
publication: Structure. 2009 Feb 13;17(2):255-65. doi: 10.1016/j.str.2008.11.011.