CAN_334

origin: Nanobody-aided structure determination of the EpsI:EpsJ pseudopilin heterodimerPm Vibrio vulnificus
author: Lam, A.Y., Pardon, E., Korotkov, K.V., Hol, W.G., Steyaert, J.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: AFSGYAMS(predict)
CDR1_length: 8
CDR2_seq: GINRDGSTS(predict)
CDR2_length: 9
CDR3_seq: WLGGRD(predict)
CDR3_lentgh: 6
protein_seq: QVQLQESGGGLVQPGGSLRLSCAASGFAFSGYAMSWVRQAPGKGLEWVSGINRDGSTSYTAPVKGRFTISRDNAKNILYLQMNSLRPEDTAVYYCAKWLGGRDWYDRGQGTQVTVS
DNA_seq: not known
PubMed_ID: 19118632
PDB_ID: 3CFI
PDB_deposition_date: 2008-03-03
PDB_released_date: 2009-01-13
resolution: 2.58Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: the EpsI:EpsJ pseudopilin heterodimerPm Vibrio vulnificus
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: crystallization aid
validationORprediction: Experiment Validation
bacteria_family: Escherichia coli
publication: J Struct Biol. 2009 Apr;166(1):8-15. doi: 10.1016/j.jsb.2008.11.008. Epub 2008 Dec 10.