CAN_337

origin: A nanobody modulates the p53 transcriptional program without perturbing its functional architecture.
author: Bethuyne, J., De Gieter, S., Zwaenepoel, O., Garcia-Pino, A., Durinck, K., Verhelle, A., Hassanzadeh
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: TFSTYAMG(predict)
CDR1_length: 8
CDR2_seq: QINWSGTTTY(predict)
CDR2_length: 10
CDR3_seq: HPQRGWGSTLGW(predict)
CDR3_lentgh: 12
protein_seq: AQVQLQESGGGLVQAGGSLRLSCAASERTFSTYAMGWFRQAPGREREFLAQINWSGTTTYYAESVKDRTTISRDNAKNTVYLEMNNLNADDTGIYFCAAHPQRGWGSTLGWTYWGQGTQVTVSSGGGGSGGGKPIPNPLLGLDSTRTGHHHHHH
DNA_seq: not known
PubMed_ID: 25324313
PDB_ID: 4QO1
PDB_deposition_date: 2014-06-19
PDB_released_date: 2014-10-29
resolution: 1.92Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: Cellular tumor antigen p53
antigen_chain: DNA-binding domain
antigen_source: Homo sapiens (human)
antigen_seq: PLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPI LTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLR
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: modulates the p53 transcriptional program without perturbing its functional architecture
validationORprediction: Experiment Validation
bacteria_family: Escherichia coli
publication: Nucleic Acids Res. 2014 Nov 10;42(20):12928-38. doi: 10.1093/nar/gku962. Epub 2014 Oct 16.