CAN_338

origin: Activation and allosteric modulation of a muscarinic acetylcholine receptor.
author: Kruse, A.C., Ring, A.M., Manglik, A., Hu, J., Hu, K., Eitel, K., Hubner, H., Pardon, E., Valant, C.,
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: DFDNFDDYA(predict)
CDR1_length: 9
CDR2_seq: REGVSCIDPS(predict)
CDR2_length: 10
CDR3_seq: WTLFHSDEY(predict)
CDR3_lentgh: 9
protein_seq: GPGSQVQLQESGGGLVQAGDSLRLSCAASGFDFDNFDDYAIGWFRQAPGQEREGVSCIDPSDGSTIYADSAKGRFTISSDNAENTVYLQMNSLKPEDTAVYVCSAWTLFHSDEYWGQGTQVTVSS
DNA_seq: not known
PubMed_ID: 24256733
PDB_ID: 4MQS
PDB_deposition_date: 2013-09-16
PDB_released_date: 2013-11-27
resolution: 3.5Ã…
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: human M2 muscarinic acetylcholine receptor 
antigen_chain: not known
antigen_source: Homo sapiens (human)
antigen_seq: DYKDDDENLYFQGLEMDDSTDSSDNSLALTSPYLEKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLF SLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMM IAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFF
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: crystallization aid
validationORprediction: Experiment Validation
bacteria_family: Escherichia coli
publication: Nature. 2013 Dec 5;504(7478):101-6. doi: 10.1038/nature12735. Epub 2013 Nov 20.