CAN_339

origin: Crystal Structure of the Bloom'S Syndrome Helicase Indicates a Role for the Hrdc Domain in Conformational Changes.
author: Newman, J.A., Savitsky, P., Allerston, C.K., Bizard, A.H., Ozer, O., Sarlos, K., Liu, Y., Pardon, E.
patent: no
publication_number: not known
patent_application_number: not known
CDR1_seq: SGGGLVQAG(predict)
CDR1_length: 9
CDR2_seq: WFSINNMAWY(predict)
CDR2_length: 10
CDR3_seq: LVADYDMGFQSF(predict)
CDR3_lentgh: 12
protein_seq: MKYLLPTAAAGLLLLAAQPAMAQVQLQESGGGLVQAGGSLRLSCAASGIWFSINNMAWYRQTPGKQRERIAIITSAGTTNYVDSVKGRFTISRDDAKNTMYLQMNSLIPEDTAVYYCNLVADYDMGFQSFWGRGTQVTVSSHHHHHH
DNA_seq: not known
PubMed_ID: 25901030
PDB_ID: 4CDG
PDB_deposition_date: 2013-10-31
PDB_released_date: 2013-11-13
resolution: 2.79Å
source_organism: Lama glama
experiment_method: llama immunization,library construction,screen,express
antigen: the Bloom's syndrome helicase BLM
antigen_chain: not known
antigen_source: not known
antigen_seq: not known
epitope: not known
IEDB_ID: not known
epitope_reference: not known
function: Structure biology
validationORprediction: Experiment Validation
bacteria_family: Escherichia coli
publication: Nucleic Acids Res. 2015 May 26;43(10):5221-35. doi: 10.1093/nar/gkv373. Epub 2015 Apr 21.